Bacterial taxon 1308539
Locus VK055_3560
Protein AIK82117.1
acetyltransferase family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 146 aa, Gene n/a, UniProt n/a
>AIK82117.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|acetyltransferase family protein
MIRKWDTEDTAPLLALWLDSTIHAHPFISESYWRDSVAVVRDVYLPAASTWVWEQDGELKGFVSVLDSRFVGALFVAPGATRQGIGRALLDEVKRHYAWLSLEVYQKNESAVSFYHAQGFRIEDCAWQDDTQHPTWIMRWPADQMP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.17 | 9.2e-6 | ●○○○○ -0.42 | -0.4168226892019766 | 26060277 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)