Bacterial taxon 1308539
Locus VK055_4672
Protein AIK83206.1
addiction module antidote protein, HigA family
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 73 aa, Gene n/a, UniProt n/a
>AIK83206.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|addiction module antidote protein, HigA family
MGEILTEEFLKPLNMSHDELAEAMGICKRYIDDIICGLRRLTDDEARVLAAVFGTDEDFWSNLQKLQDRKKRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.38 | 5.2e-6 | ●●○○○ -1.6 | -1.6036854259407516 | 26060277 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)