Bacterial taxon 1308539
Locus VK055_4093
Protein AIK82639.1
alanine racemase, N-terminal domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 233 aa, Gene n/a, UniProt n/a
>AIK82639.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|alanine racemase, N-terminal domain protein
MNDIAHNLAQVRDKISGAAARCGRAPEEVTLLAVSKTKPASAIEEAIAAGQRAFGENYVQEGVEKINHFQQAGVSGLQWHFIGPLQSNKSRLVAEHFDWCHTVDRLKIATRLNEQRPAHLPPLKVLIQINISDEQSKSGIPLEALDGLAAEIAELPHLELRGLMAIPAPESEYVRQFAVARQMAVAFARLKTRYPTVDTLSLGMSDDMEAAIAAGSTMVRIGTAIFGARDYSK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.32 | 6.7e-8 | ○○○○○ 0.04 | 0.03627747478440529 | 26060277 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)