Bacterial taxon 1308539
Locus VK055_1851
Protein AIK80457.1
amino ABC transporter, permease, 3-TM region, His/Glu/Gln/Arg/opine family domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 246 aa, Gene n/a, UniProt n/a
>AIK80457.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|amino ABC transporter, permease, 3-TM region, His/Glu/Gln/Arg/opine family domain protein
MSIDWNWGIFLQQAPFGNTTYLGWLWSGFQITVALSISAWIIAFLVGSLFGILRTVPNRFLSGIGTCYVELFRNVPLIVQFFTWYLVVPEFLPENIGMWFKSELDPNIQFFVSSMLCLGLFTAARVCEQVRAAIQSLPRGQKNAGLAMGLTLPQTYRYVLLPNAYRVIVPPMTSEMMNLVKNSAIASTIGLADMAAQAGKLLDYSAHAWESFTAITLAYVFINAVIMLIMYVVERKVRLPGNMGGK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.1 | 0.0085 | ●○○○○ -0.38 | -0.3820269941067791 | 26060277 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)