Bacterial taxon 1308539
Locus VK055_1113
Protein AIK79736.1
anti-anti-sigma factor family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 112 aa, Gene n/a, UniProt n/a
>AIK79736.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|anti-anti-sigma factor family protein
MKIETERQASVTILTPAVRRLDASVAVAFKSAIAQEIGEAPGDLIVDFSEIDFIDSSGLGTLVSLMKMMNGRGEMTLCALNPGIRNMFTLTRMDRIFRICEDRTSALAQLNE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 2.27 | 6.6e-8 | ○○○○○ 1.42 | 1.4228326350419778 | 26060277 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)