Bacterial taxon 1308539
Locus VK055_2808
Protein AIK81397.1
aspartate carbamoyltransferase, regulatory subunit
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 153 aa, Gene n/a, UniProt n/a
>AIK81397.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|aspartate carbamoyltransferase, regulatory subunit
MTHDNKLQVEAIKRGTVIDHIPAQVGFKLLTLFKLTETDQRITIGLNLPSGEMGRKDLIKIENTFLTDEQVNQLSLYAPQATVNRIDDYEVVGKSRPSLPDRIDSVLVCPNSNCISHAEPVSSSFAVKKRADDIALKCKYCEKEFSHYVVLAN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.09 | 0.0026 | ○○○○○ 0.16 | 0.16214664467985943 | 26060277 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)