Bacterial taxon 1308539
Locus VK055_4431
Protein AIK82974.1
bacterial regulatory helix-turn-helix, lysR family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 293 aa, Gene n/a, UniProt n/a
>AIK82974.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|bacterial regulatory helix-turn-helix, lysR family protein
MKFKQIQAFITVAREGNMTLAAEKMGITQSGLSRLLLSLEADLSASLFERHKHGMALSEYGSAFLPYALTMLNTEQKAREEIELIRGAGKGILRIGCVSSLLTSHFIDKLAAFHQRHPQIHLRIVDRIDSELYKLLLMHDIDIALCGPLPHDEKIVVRGKINWQDRICIVARQHHPLHQAADVTLEAMLDYPWIMPPPSSTPMNILADIFRARQLPCPQPVIECASSSAIKAFLCESDLLTSMPAPVYRHEEALGLLRPFELEGSVFIRDFYAYSHFGVLSGAALQLIQHLKQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 2,32 | <1e-323 | ○○○○○ 1,45 | 1.4502549361147914 | 26060277 |
Retrieved 1 of 1 entries in 0,4 ms
(Link to these results)