Bacterial taxon 1308539
Locus VK055_2917
Protein AIK81502.1
blc outer membrane lipoprotein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 177 aa, Gene n/a, UniProt n/a
>AIK81502.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|blc outer membrane lipoprotein
MRILPIITAIAVSFLSVACSTPTPPPGVTVVSPFDVQRYLGTWYEIARFDHPFESGLEKVTIAWHPRDDGGLDVVNKGYNPDRGMWQKTDGVAYFTGEPSRAALKISFFGPFYGSYNVIALDKEYRYALVCGPDRDYLWLLARAPTIAPEVRQQMLDIATRQGFDVGKLVWVNQRYD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.4 | 0.029 | ●○○○○ -0.01 | -0.0057511671138504765 | 26060277 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)