Bacterial taxon 1308539
Locus VK055_4022
Protein AIK82569.1
catalytic LigB subunit of aromatic ring-opening dioxygenase family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 258 aa, Gene n/a, UniProt n/a
>AIK82569.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|catalytic LigB subunit of aromatic ring-opening dioxygenase family protein
MPALFLGHGSPMNVLEDNRYTRAWAQLGETLPRPKAIVVVSAHWFTRGTGVTAMEAPKTIHDFGGFPQALYDTHYPAPGSPALAQRLVELLSPVPVTLDTEAWGFDHGSWGVLIKMYPQADIPMVQLSIDSTKPPAWHLEMGRKLASLRDEGIMLVASGNVVHNLRTARWHGENTPYPWAESFNNYVKANLQWQGLDEQHPLVNYLAHEGGSLSNPTAEHFLPLLYVLGTWDGVEAMTIPVDGIEMGSLSMLSVLVGA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.14 | 0.00021 | ○○○○○ 0.13 | 0.1301824835714034 | 26060277 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)