Bacterial taxon 1308539
Locus VK055_2579
Protein AIK81176.1
creA family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 157 aa, Gene n/a, UniProt n/a
>AIK81176.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|creA family protein
MKYKKFAMGLLLLTGSQLAQAEQIGSVDTVFKWLGPDHKIVVEAFDDPDVQNVTCYISRAKTGGIKGGLGLAEDTSDAAISCQQVGPIELTDKIKNGKSQGDVVFQKRTSLVFKKLQVVRFYDAKRNALVYLTYSDKVVDGSPKNAISAVPIMPWNK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 2.34 | 1.0e-10 | ○○○○○ 1.46 | 1.4641183928967625 | 26060277 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)