Bacterial taxon 1308539
Locus VK055_4269
Protein AIK82814.1
cupin 2, conserved barrel domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 108 aa, Gene n/a, UniProt n/a
>AIK82814.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|cupin 2, conserved barrel domain protein
MFIFHKDTTLEDLGNGVTRRILAHDGKMMAVEVNFAAGAVGPMHNHPHEQLTYVLSGEFEFTIGEETRVVSAGDTLYKRPGIMHGCVCLQPGTLLDTFTPIREDFLEG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.22 | 0.016 | ○○○○○ 0.32 | 0.32478586457104436 | 26060277 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)