Bacterial taxon 1308539
Locus VK055_4117
Protein AIK82663.1
cupin domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 158 aa, Gene n/a, UniProt n/a
>AIK82663.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|cupin domain protein
MEEWVESRIARFEGRKYDWNALKFQADFDPKYRRAQMRYIGTGATGVASDTNTVPAEHFTFSTMVLPSKCEGPLHLHDDVEEVFFMLKGQITLMIQDGDNYTETVLRERDLISVPPGIYRGLFNHGEEEALMCVMLGTHKPHIPTYPEDHPLAKVKRN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.35 | 1.3e-11 | ○○○○○ 0.39 | 0.3943811242904857 | 26060277 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)