Bacterial taxon 1308539
Locus VK055_1788
Protein AIK80401.1
cyd operon protein YbgT
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 38 aa, Gene n/a, UniProt n/a
>AIK80401.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|cyd operon protein YbgT
MWYFAWILGTLLACAFGVITALALEHVEATKAGKKEEI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.28 | 0.011 | ○○○○○ 0.36 | 0.3605248441556592 | 26060277 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)