Bacterial taxon 1308539
Locus VK055_2163
Protein AIK80768.1
cytochrome o ubiquinol oxidase subunit IV
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 109 aa, Gene n/a, UniProt n/a
>AIK80768.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|cytochrome o ubiquinol oxidase subunit IV
MSHSTDHSGASHGSVKSYMTGFILSIILTVIPFAMVMSGSASHAVILGTILVTAVVQIVVHLVYFLHMNSKSDEGWNLTAFIFTVIIIAIVVVGSIWIMWNLNYNMMMH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.44 | 5.6e-6 | ●●○○○ -1.1 | -1.1026348011531635 | 26060277 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)