Bacterial taxon 1308539
Locus VK055_3303
Protein AIK81864.1
DSBA-like thioredoxin domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 207 aa, Gene n/a, UniProt n/a
>AIK81864.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|DSBA-like thioredoxin domain protein
MKKVWLALAGMILAFSASAAQITDGKQYITLDKPIAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVRQKLPEGTKMTKYHVEFLGPLGKDLTQAWAVAIALGVEDKITAPMFEAVQKNQTVQSVADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAAADLQLQGVPAMYVNGKYQLNPQGMDTSNMDVFVAQYADTVKQLVEKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.51 | 0.0038 | ●●○○○ -1.14 | -1.1388726780063223 | 26060277 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)