Bacterial taxon 1308539
Locus VK055_4918
Protein AIK83444.1
elongation factor P (EF-P) OB domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 190 aa, Gene n/a, UniProt n/a
>AIK83444.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|elongation factor P (EF-P) OB domain protein
MPRANEIKKGMVLNYNGKLLIVKNIDIQSPSARGAATLYKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRFVDFSYVDGNEYVFMDKEDYTPYTFTKEQIEEELQFIPEGGMPDMQVLTWDGQLLALELPQTVDLEIIETAPGIKGASASSRTKPATMSTGLVIQVPEYLTTGEKIRIHIEECRYMGRAD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.35 | 1.9e-5 | ○○○○○ 0.02 | 0.022762785928272043 | 26060277 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)