Bacterial taxon 1308539
Locus VK055_1479
Protein AIK80100.1
fe(3+)-binding periplasmic protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 338 aa, Gene n/a, UniProt n/a
>AIK80100.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|fe(3+)-binding periplasmic protein
MKFRLSPLRTAALVAASLFLAPQGMAADAQNGIVVYNAQHENLVKSWVDGFTKETGIKVTLRNGDDSELGNQLVQEGSASPADVFLTENSPSMVLVDNAKLFAPLDAATLQQVPAQYRPQHGRWIGIAARSTVFVYNPAKISEAQLPHSLMDLAKPEWKGRWAASPSGADFQAIVSAMLALKGEQATLDWLKAMKTNFVAYKGNSTVMKAVNAGQIDGGVIYHYYRFVDQSKTGENSKNTQLYYFKHQDPGAFVSISGGGVLASSKHKAQAQAFIKWITGKQGQDALRTNNAFEYAVGVDAASNPKLTPLKDLDAPKVEPSSLNSKKVIELMTQAGLL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.76 | 1.5e-5 | ○○○○○ 1.15 | 1.152248582972413 | 26060277 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)