Bacterial taxon 1308539
Locus VK055_3466
Protein AIK82022.1
ferredoxin-NADP reductase
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 248 aa, Gene n/a, UniProt n/a
>AIK82022.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|ferredoxin-NADP reductase
MADWVSGKVTKVEYWTDALFSLYVRAPVHPFTAGQFTKLGLEIDGERVQRAYSYVNAPGNPDLEFYLVTVPEGKLSPRLAALKPGDEVLVVSEAAGFFVLEEVPDCDTLWMLATGTALGPYLSILQEGKDLERFNNLVLVHAVRYAADLSYLPLMRELEQRYAGKLRIQTVVSRETVEGSLTGRVPFLIETGALEEAVGLPMTTDTSHVMLCGNPQMVRDTQQLLKETRQMTKHLRRRPGHMTAEHYW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.07 | 0.032 | ○○○○○ 0.17 | 0.16870506360060902 | 26060277 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)