Bacterial taxon 1308539
Locus VK055_1411
Protein AIK80034.1
glyoxylate reductase / hydroxypyruvate reductase
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 312 aa, Gene n/a, UniProt n/a
>AIK80034.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|glyoxylate reductase / hydroxypyruvate reductase
MEIIFYHPTFDTQYWICELEKQLPGARVREWKAGDNRPADYALVWHPPVEMLQGRALKAVFALGAGVDSILSKLRDHPDMLPLSIPLFRLEDTGMGRQMQEYAVSQVLHWFRRFDDYQALKLASRWQPLPEYRADEFTVGIMGAGVLGAKVAESLQPWGFPLRVWSRSRKSWPQVQSFAGQAELGEFLQGTRVLINLLPNTAETAGIINQTLLAQLPDESYVLNLARGVHVVEEDLLAALNSGKLKGAMLDVFSREPLPQESPLWAHPRVAMTPHVAAVTRPMEAITYIAETISRLERGEPVSGQVDRQRGY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.65 | 7.2e-6 | ○○○○○ 1.09 | 1.0918297902433198 | 26060277 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)