Bacterial taxon 1308539
Locus VK055_5053
Protein AIK83579.1
gyrI-like small molecule binding domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 157 aa, Gene n/a, UniProt n/a
>AIK83579.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|gyrI-like small molecule binding domain protein
MNYSITTLGKKTIAGFHLVGPWDHTVKQGFEQLMMWVENHQVPACEWVAVYYDNPEEVPAEKLRCATAVTVDEDYVIPANSEGVILAAIAGGDYACARARVVDYDFATPWMQFFDSLQQSTAYRIAPQPCFEVYLNDGNHDGYWDIDMYVPVERVAS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.37 | 4.1e-15 | ○○○○○ 0.94 | 0.9432680685316662 | 26060277 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)