Bacterial taxon 1308539
Locus VK055_2030
Protein AIK80636.1
hypothetical protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 114 aa, Gene n/a, UniProt n/a
>AIK80636.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hypothetical protein
MTLDYVALAILIAVALILFYGVIVIHDIPYEIAKERRHPHQDAIHYAGWVSLFTLHALWPLLWIWATLWREDRGWGMRHIADDQQALHQRLETVVQQLEQVQREVDVLKAKEAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.92 | 9.8e-9 | ○○○○○ 1.24 | 1.2373304920711399 | 26060277 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)