Bacterial taxon 1308539
Locus VK055_2620
Protein AIK81214.1
hypothetical protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 157 aa, Gene n/a, UniProt n/a
>AIK81214.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hypothetical protein
MGIISFIFALAEDMLLAAIPAVGFAMVFNVPQRALRWCALLGAIGHGSRMIMMSAGFNIEWATFLAALLVGSIGIQWSRWYLAHPKIFTVAAVIPMFPGISAYTAMISAVKISHFGYSEEMMILLLSNFLKASSIVGALSIGLSIPGLWLYRKRPRV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -4.56 | 2.2e-5 | ●●●○○ -2.24 | -2.2351648466818337 | 26060277 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)