Bacterial taxon 1308539
Locus VK055_5152
Protein AIK83673.1
hypothetical protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 44 aa, Gene n/a, UniProt n/a
>AIK83673.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hypothetical protein
MNIDPENYSKYTLRRFAALLDVICWVLIAVVTVGICMFIEWWIA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.36 | 0.0022 | ○○○○○ 0.4 | 0.403330957465232 | 26060277 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)