Bacterial taxon 1308539
Locus VK055_1716
Protein AIK80336.1
inhibitor of apoptosis-promoting Bax1 family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 214 aa, Gene n/a, UniProt n/a
>AIK80336.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|inhibitor of apoptosis-promoting Bax1 family protein
MAQVYGWMTVGLLLTAFIAWFAANTPAVMMFVFSSKITFFGLIIAQLALVFVLSGMVQRLSAGMATTLFMLYSALTGLTLSSIFIAYTYSSIASTFVVTGGMFGAMSLYGYTTKRDLSGFGSMLFMGLIGIVLASLVNLWLKSEALMWAVTYIGVVLFVGLTAYDTQKLKNIGEQIDTRDSATLRKYSILGALTLYLDFINLFLMLLRIMGNRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.23 | 1.5e-11 | ○○○○○ 0.87 | 0.8683642217668915 | 26060277 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)