Bacterial taxon 1308539
Locus VK055_3687
Protein AIK82242.1
iron-sulfur cluster scaffold protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 191 aa, Gene n/a, UniProt n/a
>AIK82242.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|iron-sulfur cluster scaffold protein
MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEDTDTALKFEQLTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVSDDAPLMERVEYLLQSQINPQLAGHGGRVSLMEITDDGLAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDLTEHQRGEHSYY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -5.78 | 0.031 | ●●●○○ -2.89 | -2.890534044646743 | 26060277 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)