Bacterial taxon 1308539
Locus VK055_4360
Protein AIK82903.1
L-fuculose phosphate aldolase
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 215 aa, Gene n/a, UniProt n/a
>AIK82903.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|L-fuculose phosphate aldolase
MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTEDKIVFIDAEGQHEQGKLPSSEWRFHQAAYQTRPDAQAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGGNSIPCAPYATFGTRELSEHVAVALKHRKATLLQHHGLIACEASLEKALWLAHEVEVLAQLYLSTLAITDPVPVLDDEAIAIVLEKFKTYGLRIEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.41 | 0.00053 | ●●○○○ -1.09 | -1.0853781224700212 | 26060277 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)