Bacterial taxon 1308539
Locus VK055_4927
Protein AIK83453.1
LYSR-type transcriptional regulator
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 288 aa, Gene n/a, UniProt n/a
>AIK83453.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|LYSR-type transcriptional regulator
MHITLRQLEVFAEVHKSGSTTQASQMLALSQSAVSAALTDLEGQLGVQLFDRVGKRLVVNEHGRLLYPRALALLERALEIEQLFRGDNGAIRVYASSTIGNYIMPEIIARYRHDFPDLPVELSVGNSLDVINAVADLRVDFGLIEGPCHAADIIAEPWLEDELVVFAAPNSPLLAGEVTLQQLAEAPWILREHGSGTREIVDYVLLSHLPAFHLGMELGNSEAIKHAVRHGLGISCLSRRVIAEQLASGTLAELKVPLPRLTRTLWRIHHRQKHISKALQRFLHYCQV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.88 | 0.001 | ●○○○○ -0.26 | -0.26283844264212275 | 26060277 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)