Bacterial taxon 1308539
Locus VK055_2363
Protein AIK80960.1
modulator of Rho-dependent transcription termination
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 84 aa, Gene n/a, UniProt n/a
>AIK80960.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|modulator of Rho-dependent transcription termination
MNDTYQPINCDDYDNLELACQHHLVLTLALKDGEQLQAKASDLISRKNIEYLVVELAGNVRELRLDKIASFSHPEIGTVVVSES
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.57 | 1.8e-12 | ●●○○○ -1.17 | -1.1705616597333357 | 26060277 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)