Bacterial taxon 1308539
Locus VK055_4432
Protein AIK82975.1
nitrous oxide-stimulated promoter family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 113 aa, Gene n/a, UniProt n/a
>AIK82975.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|nitrous oxide-stimulated promoter family protein
MGKRIEREKMTIQRMIALYQRRSPEAQADDAHYQALNAYADKRLDKCVFGENKPACKQCPVHCYQPAKREEMKQIMRWAGPRMLWRHPILTIRHLLDDRRPVPPLPEKYRPKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.55 | 4.0e-7 | ●●○○○ -1.16 | -1.1600245814434282 | 26060277 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)