Bacterial taxon 1308539
Locus VK055_2277
Protein AIK80882.1
nlpC/P60 family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 188 aa, Gene n/a, UniProt n/a
>AIK80882.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|nlpC/P60 family protein
MKPKLTHALFLIPFLLLAGCSSSPKQAKNTKSHADMTIDSGSDDLIPVVAALHDQMHTWQGTPYEWGGTEQSGVDCSGFVWRTLKDRFNLPMERITTRELLHMGVRVNKRDLRPGDLVFFRTRAGMHVGFYDTDHNFLHASSSQGVMRSSLDNPYWESAFYQARRLPKEYNAQITMNSDTLHLAKNRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.38 | 0.036 | ●○○○○ -0.53 | -0.5341745477450219 | 26060277 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)