Bacterial taxon 1308539
Locus VK055_5162
Protein AIK83683.1
phage antitermination Q family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 192 aa, Gene n/a, UniProt n/a
>AIK83683.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|phage antitermination Q family protein
MINPSEVGKAGEMVRLKTLEAIWIQGNLRMWGRWSYIGGGSGGNMFNQLLASGKITKTAINEALRRMKKSGISKPELEAFFREILAGKNKSGLAFCTDDEGLLIDKVLGAVLITGGHKELYYLLVEHYRLRKSKRRIAEELYEKHPDWCFMTCRRRVDAWISLAESMLYAPMCDAFGTNGDRFYLQSEPETA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.58 | 0.00022 | ●○○○○ -0.64 | -0.6380742866038387 | 26060277 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)