Bacterial taxon 1308539
Locus VK055_1733
Protein AIK80353.1
phosphatidylethanolamine-binding family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 158 aa, Gene n/a, UniProt n/a
>AIK80353.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|phosphatidylethanolamine-binding family protein
MKLISHDLQDGGKLPNRHVFNGMGYDGDNISPHLMWDDVPAGTKSFVVTCYDPDAPTGSGWWHWVVANLPADTRVLPQGAGSGQAELPEEAVQTRTDFGKAGYGGAAPPKGETHRYIFTVHALDVEKIEVDAEASGAMVGFNVHFHSLASASITALFS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.56 | <1e-323 | ○○○○○ 1.04 | 1.042036891155225 | 26060277 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)