Bacterial taxon 1308539
Locus VK055_2228
Protein AIK80833.1
psiF repeat family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 105 aa, Gene n/a, UniProt n/a
>AIK80833.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|psiF repeat family protein
MKITLLMTLLFGLIFISAVGAAEKTPTPQQQRMTDCNQQAAAKMLKGEERKTFMSQCLKKETTTSQGKALTPQQQKMSDCSKAATAKSLKGDERSTFMSSCLKKA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.64 | 2.8e-9 | ●○○○○ -0.14 | -0.1350623299820976 | 26060277 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)