Bacterial taxon 1308539
Locus VK055_2431
Protein AIK81028.1
PTS system fructose IIA component family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 146 aa, Gene n/a, UniProt n/a
>AIK81028.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|PTS system fructose IIA component family protein
MLGWVITCHDELAQEMLDRLEQKFGPLAQCRAVNYWRNLSSNMLSRMMCDALHATDSGDGVIFLTDKTGAAPYRAAALMSHKHTHCEVISGVSYPLLERMYLLRGTLSSVAFRQAIVSAGGPMVSSLWHQQQKNPPFRLRHDAWGN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.67 | 5.3e-11 | ●○○○○ -0.69 | -0.6865382576602564 | 26060277 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)