Bacterial taxon 1308539
Locus VK055_3594
Protein AIK82149.1
putative antibiotic biosynthesis monooxygenase
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 61 aa, Gene n/a, UniProt n/a
>AIK82149.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|putative antibiotic biosynthesis monooxygenase
MHHVSPEYSQKAAFILEMRFSSHYARQVKKIMERCFNMIDQQNSAAHTSAYIDSIAGSGYV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.36 | 8.4e-11 | ●●○○○ -1.59 | -1.5922844261490612 | 26060277 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)