Bacterial taxon 1308539
Locus VK055_5062
Protein AIK83588.1
putative lipoate-protein ligase A
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 246 aa, Gene n/a, UniProt n/a
>AIK83588.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|putative lipoate-protein ligase A
MSQLTLADCWPRRFYPSSLALQFCEDPTQAEQPLFAKASAGEAVAQLWQAPQGLVVPGSYRQFTDLPAVSAHFAARGWPVWLRRSGGGLVPQGPGIINLSLAWPVQQPLGEAAEPIYHSLCAVLQRTLARFGVASHPRAVSGSFCDGRYNLACGEGAEARKIVGTAQYWRPLAAGGGHVVLAHAVILIDADLSAAHQAANAFEAQLGSERVYCADKTVTLAQLLPGERHLQPRFSEALAQELDAAR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.07 | 0.0019 | ○○○○○ 0.78 | 0.7814266646803455 | 26060277 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)