Bacterial taxon 1308539
Locus VK055_4351
Protein AIK82894.1
putative lipoprotein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 76 aa, Gene n/a, UniProt n/a
>AIK82894.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|putative lipoprotein
MKMTKAAAIISACMLTLGLSACSSNYVMHTNDGRTIVTDGKPQTDNDTGMISYKDAWGNKQQINRSDVKQLGELDE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.19 | 0.0056 | ○○○○○ 0.1 | 0.10466471809928511 | 26060277 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)