Bacterial taxon 1308539
Locus VK055_4556
Protein AIK83094.1
putative oxalate/formate antiporter
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 266 aa, Gene n/a, UniProt n/a
>AIK83094.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|putative oxalate/formate antiporter
MLNTLPDLHRSFAEQLKLKLQSDSRIHSLLAGGSFIHGGFDQYSDLDFVVVIDPLYYDEIMAQRMVFAGTLGHLLHAFTGEHVGEPRLLICLFGPELLHVDLKFITLDMLTQRVEEPAVLFTRDNDALKRQLAKFSAHWPNMTPEWFESRAWIWLHYAVVKLGRGELFEALGMLSFFREQVLGPMLFRRANLPQRGVRRIEALGIDPDGLLTSTLATHDRHSVGIAIRRAADAYVTLRADALPDNIADDAARRAVLAMLDAYSHKG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.37 | 1.7e-15 | ●●○○○ -1.06 | -1.062411645084709 | 26060277 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)