Bacterial taxon 1308539
Locus VK055_2361
Protein AIK80958.1
putative-tRNA hydrolase domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 137 aa, Gene n/a, UniProt n/a
>AIK80958.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|putative-tRNA hydrolase domain protein
MITISRSVALADDEIVLSGIRAQGAGGQHVNKASTAIHLRFDIKASSLPEFYKERLLAASHHLISADGVVIIKAQEYRSQEMNREAAIARLVALIKELTAVQKSRRETRPTRASKERRLASKAQKSSVKALRGKVRQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.86 | 0.049 | ○○○○○ 0.67 | 0.6673966412549284 | 26060277 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)