Bacterial taxon 1308539
Locus VK055_1554
Protein AIK80174.1
pyruvate formate-lyase 1-activating enzyme
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 246 aa, Gene n/a, UniProt n/a
>AIK80174.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|pyruvate formate-lyase 1-activating enzyme
MSVIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEITVEELMKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAQYLAKKNINVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVHPPKKETMERVKGILEQYGHKVMY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 2.75 | 7.5e-9 | ○○○○○ 1.68 | 1.6823272874724104 | 26060277 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)