Bacterial taxon 1308539
Locus VK055_4089
Protein AIK82635.1
radical SAM superfamily protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 379 aa, Gene n/a, UniProt n/a
>AIK82635.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|radical SAM superfamily protein
MANLPPLSLYIHIPWCVQKCPYCDFNSHALKGEVPHDDYVQHLLNDLQADAQYAQGREIGTIFIGGGTPSLLSGPAMQTLLDGVRACLPLAAGAEITMEANPGTVEADRFVDYQRAGVNRISIGVQSFSEPKLQRLGRIHGPEEAKRAARLASGLGLRSFNLDLMHGLPDQSLEEALDDLRQAIALNPPHLSWYQLTIEPNTLFGSRPPVLPDDDALWDIFELGHQLLSAAGYQQYETSAYAKPGFQCQHNLNYWRFGDYLGIGCGAHGKITFPDGRILRTAKTRHPRGYMEGRYLERQHDVEEADKPFEFFMNRFRLLEAAPRAEFSLYTGLDEQVIRQQIDAAIAEGYLLEDAQNWQITEHGKLFLNSLLELFLSEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.8 | 0.0051 | ●○○○○ -0.22 | -0.22161181696358986 | 26060277 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)