Bacterial taxon 1308539
Locus VK055_3520
Protein AIK82076.1
tRNA (cytidine(34)-2'-O)-methyltransferase
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 157 aa, Gene n/a, UniProt n/a
>AIK82076.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|tRNA (cytidine(34)-2'-O)-methyltransferase
MLNIVLFEPEIPPNTGNIIRLCANTGFSLHIIEPMGFTWDDKRLRRAGLDYHEFTAVQRYADYAAFVASAQPQRLFALTTKGTPAHSAVSYQDGDFLMFGPETRGLPASILDALPPEQKIRIPMMPDSRSMNLSNAVSVVVYEAWRQLGYPGAVLRS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.46 | 0.022 | ○○○○○ 0.45 | 0.454846366166019 | 26060277 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)