Bacterial taxon 1308539
Locus VK055_2613
Protein AIK81207.1
ybaK / prolyl-tRNA synthetases associated domainprotein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 152 aa, Gene n/a, UniProt n/a
>AIK81207.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|ybaK / prolyl-tRNA synthetases associated domainprotein
MSLQSVRQFFAEHAPDIEIIELNQSTATVALAAAAHNVEPGQIAKTLSLKIKDKIVLIVARGDARLDNKKLKETFGAKARMLSSDEVVTWTGHPVGGVCPFGLENPLAVYCDVSLRHYQEVLPAAGAIHSAVRIEPERMAQLTDATWVDVCL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 2.04 | 9.0e-12 | ○○○○○ 1.3 | 1.3018679894091196 | 26060277 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)