Bacterial taxon 1308539
Locus VK055_3543
Protein AIK82099.1
yiaA/B two helix domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 134 aa, Gene n/a, UniProt n/a
>AIK82099.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|yiaA/B two helix domain protein
MISWIALIGGIVTYLVGLWNADMQLNEKGYYFAVLVLGLFAAASYQKTVRDKYEAIPTTALYYTTCLVVFVIAVGLLVIGLWNATLLLSEKGFYGLAYFLSLFGAVAVQKNVRDVWDPTRLREPLSVTEEGPET
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.92 | <1e-323 | ○○○○○ 0.7 | 0.7016449660582154 | 26060277 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)