Bacterial taxon 262316
Locus MAP_0778
Protein AAS03095.1
hypothetical protein
Mycobacterium avium subsp. paratuberculosis K10
Length 174 aa, Gene n/a, UniProt Q742Q7
>AAS03095.1|Mycobacterium avium subsp. paratuberculosis K10|hypothetical protein
MSLLGTGPILAFSFRENNIIAAGPGTFIGEAGGDSVRNRFVAAGAALTVALLGACTSRPPAQLSSTASVTVDGKDRNFHIVTCRQLEWRRMIDIGADFSGAKVAVDENAQPPVVESVHIQNLSGFSGMYSRGGSGSADMSMTGDKFTISGTADGYKTDKPSEPATATFKIVVTC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 799,560 | -4.94 | 0.02 | ●●○○○ -1.94 | -1.9410833418471936 | 24885784 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)