Bacterial taxon 262316
Locus MAP_1035c
Protein AAS03352.1
hypothetical protein
Mycobacterium avium subsp. paratuberculosis K10
Length 203 aa, Gene n/a, UniProt Q741Q3
>AAS03352.1|Mycobacterium avium subsp. paratuberculosis K10|hypothetical protein
MGSLLVMLAIVLFIASIVVLVVALRRPKQPARPAGRPDPLAADALPQFGPRQLGPGAVVSYGGTDYIVRGSVTYREGPFVWWEHLLEGGDQPLWFSVEEDDGRLQLALWVTRKDLSLRPGDNYVVDGVTFHESERGRASYTTEGTTGLPAGGEMEFVDCTNADETALLSFERWAPDMPWEVSTGRPVSPGEITVYAAPPPSSA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 1,080,740 | 5.46 | 0.045 | ○○○○○ 1.47 | 1.4669052026250966 | 24885784 |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 1,080,524 | 5.65 | 0.041 | ○○○○○ 1.53 | 1.5277087536518772 | 24885784 |
Retrieved 2 of 2 entries in 1.6 ms
(Link to these results)