Bacterial taxon 262316
Locus MAP_1191
Protein AAS03508.1
hypothetical protein
Mycobacterium avium subsp. paratuberculosis K10
Length 159 aa, Gene n/a, UniProt Q741A1
>AAS03508.1|Mycobacterium avium subsp. paratuberculosis K10|hypothetical protein
MRLEQMYQDVILDHYKHPQHRGLREPFGAEVFHVNPVCGDEVTLRVTLSDDGETVADVSYDGQGCSISQAATSVLTEQVIGRSVEEALDTIGAFAEMVSSRGAVEGDEDVLGDGIAFAGVAKYPARVKCALLGWMACKDALAQAYSRREVTDERNHRAG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 1,252,268 | -3.63 | 0.042 | ●●○○○ -1.51 | -1.5121164352230283 | 24885784 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)