Bacterial taxon 262316
Locus MAP_1202
Protein AAS03519.1
hypothetical protein
Mycobacterium avium subsp. paratuberculosis K10
Length 208 aa, Gene n/a, UniProt Q740Z0
>AAS03519.1|Mycobacterium avium subsp. paratuberculosis K10|hypothetical protein
MPAERHTRVTAGAERHASVTAAAGGTTMTAHDSAPPLYIPVDVDMTMVKAAVAATGVSAPPAAMPGLLEVVNQARAEGINLKIVLLDHNPPNDTPLRDISTVVGADYHDATVLTLSPNYVGSYSTQFPRVTLEAGEDIAKTGNPVVSAQHFLHELDTPEFPWTGLTIFLLIAVFAAAVGTRVLQVRSRRAATPPDAAGADTVTPTNTA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 1,263,710 | -3.96 | 0.035 | ●●○○○ -1.62 | -1.6217612853071757 | 24885784 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)