Bacterial taxon 262316
Locus MAP_1527c
Protein AAS03844.1
hypothetical protein
Mycobacterium avium subsp. paratuberculosis K10
Length 172 aa, Gene n/a, UniProt Q73ZS4
>AAS03844.1|Mycobacterium avium subsp. paratuberculosis K10|hypothetical protein
MAACSKWRAPLSGIAPGFAERTAPMSTRYEEPNRAARAANVVVRWLADAGVSIAGTRALRVRGRKTGKLRAVVVNLLTVAGTDYLVSPRGDTQWARNVRAASVVELGPRWRRRRMRVSEVDDAAKPQLLRRYLDRWYWQVKDYVAGLTPDSSDEQFRAAAPTIPVFALTKAG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 1,677,599 | -11.21 | 4.4e-5 | ●●●●○ -4 | -3.9984000465679523 | 24885784 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)