Bacterial taxon 262316
Locus MAP_2009
Protein AAS04326.1
hypothetical protein
Mycobacterium avium subsp. paratuberculosis K10
Length 207 aa, Gene n/a, UniProt Q73YE7
>AAS04326.1|Mycobacterium avium subsp. paratuberculosis K10|hypothetical protein
MAGIDKIVTHGTFELDGGSWEVDNNIWIVGDDSDVVVFDAAHTAEPIVAAVGNRNVVAVVCTHGHNDHVTVAPELGAALDAPVLLHPGDDVLWRMTHPDKDFRTIADGDTIDVAGTELLALHTPGHSPGSVCWYAPELGVVFSGDTLFSGGPGATGRSYSDFPTILQSISGRLGTLPGETVVHTGHGDSTTIGDEIVHYEEWVARGH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 2,218,697 | -5.5 | 0.014 | ●●●○○ -2.12 | -2.1248748882367345 | 24885784 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)